Showing 81 - 100 results out of 2,512,817 with the query:
*
with sorting:
Target Antigen Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Purified (azide-free) anti-0N Tau antibody Go To Vendor
0N Tau See NCBI gene human
(BioLegend Cat# 823802, RRID:AB_2783399)
monoclonal antibody
Applications: WB, IHC-P
Clone 3H6.H7
mouse
BioLegend
823802 also 823801
Anti-10/4/2011 Antibody
10/4/2011 human
(Signalway Cat# 21424, RRID:AB_10759862)
polyclonal antibody
Applications: Western Blot
rabbit
Signalway
21424 also 21424-2
Anti-PTEN, C-terminus, clone A2b1 antibody
A 10 AA peptide near the c-terminus end human, mouse, rat
(Millipore Cat# MAB4037, RRID:AB_2253293)
monoclonal antibody
Used By NYUIHC-40
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE
[A2b1]
mouse
Millipore
MAB4037
Rabbit Anti-10-formyltetrahydrofolate dehydrogenase Polyclonal Antibody, Unconjugated
10-formyltetrahydrofolate dehydrogenase rat
(Millipore Cat# ABN57, RRID:AB_10805941)
polyclonal antibody
seller recommendations: Western Blot; Western Blotting
rabbit
Millipore
ABN57
10 L Batch Bioreactor antibody
10 L Batch Bioreactor
(Rockland Cat# MAB-032, RRID:AB_10893387)
unknown
manufacturer recommendations:
Rockland
MAB-032
Mouse Anti-Human MARCH10 Monoclonal Antibody
10-Mar human
(Creative Diagnostics Cat# CABT-34789MH, RRID:AB_2355903)
monoclonal antibody
144
mouse
Creative Diagnostics
CABT-34789MH
Anti-MARCH10 antibody Go To Vendor
10-Mar epitope: LPDRESATEKDRGGSENAKKSPLSWDTKSEPRQEVGVNAENVWSDCISVEHRPGTHDSEGYWKDYLNSSQNSLDYFISGRPISPRSSVNSSYNPPAS See NCBI gene human
(Atlas Antibodies Cat# HPA023322, RRID:AB_1856351)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA023322
SEPT10 antibody Go To Vendor
10-Sep human, mouse, rat
(Proteintech Cat# 12420-1-AP, RRID:AB_2186992)
polyclonal antibody
Originating manufacturer of this product.
Applications: WB, IHC, IF, ELISA
rabbit
Proteintech
12420-1-AP
Mouse Anti-Human SEPT10 Monoclonal Antibody
10-Sep human
(Creative Diagnostics Cat# CABT-35948MH, RRID:AB_2356883)
monoclonal antibody
144
mouse
Creative Diagnostics
CABT-35948MH
Anti-SEPT10 antibody Go To Vendor
10-Sep epitope: LLEEEIIAFSKKKATSEIFHSQSFLATGSNLRKDKDRKNSNF See NCBI gene human
(Atlas Antibodies Cat# HPA060310, RRID:AB_2684249)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA060310
Anti-SEPT10 antibody Go To Vendor
10-Sep epitope: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG See NCBI gene human
(Atlas Antibodies Cat# HPA047860, RRID:AB_2680187)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA047860
Anti-SEPT10 antibody Go To Vendor
10-Sep epitope: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG See NCBI gene human
(Atlas Antibodies Cat# HPA056304, RRID:AB_2683094)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA056304
Anti-1100001H23RIK, (N-terminal) antibody produced in rabbit
1100001H23RIK (N-terminal) antibody produced in rabbit mouse
(Sigma-Aldrich Cat# SAB2105345, RRID:AB_10740451)
polyclonal antibody
Vendor recommendations: Western Blot; immunoblotting: suitable
rabbit
Sigma-Aldrich
SAB2105345
1100001H23Rik (phospholipase B domain containing 1) Antibody (against the n terminal of 1100001H23Rik)(50ug)
1100001H23Rik (phospholipase B domain containing 1) (against the n terminal of 1100001H23Rik)(50ug) mouse
(Aviva Systems Biology Cat# ARP37350_P050, RRID:AB_10714817)
polyclonal antibody
manufacturer recommendations: WB,DT
rabbit
Aviva Systems Biology
ARP37350_P050
1110033M05RIK Antibody
1110033M05RIK mouse, m
(ProSci Cat# 28-711, RRID:AB_10908548)
unknown
manufacturer recommendations: ELISA; Western Blot; 1110033M05RIK antibody can be used for detection of 1110033M05RIK by ELISA at 1:312500. 1110033M05RIK antibody can be used for detection of 1110033M05RIK by western blot at 0.5 & 956;g/mL, and HRP conjugated secondary antibody should be diluted 1:50,000 - 100,000. E, WB
rabbit
ProSci
28-711
1110033M05RIK Antibody (against the N terminal of 1110033M05RIK) (50ug)
1110033M05RIK (against the N terminal of 1110033M05RIK) (50ug) mouse
(Aviva Systems Biology Cat# ARP37640_P050, RRID:AB_593075)
polyclonal antibody
manufacturer recommendations: IgG WB; Western Blot; ELISA
rabbit
Aviva Systems Biology
ARP37640_P050
1110033M05Rik (Fam172a family with sequence similarity 172, member A) Antibody (against the n terminal of 1110033M05Rik) (50??µg)
1110033M05Rik (Fam172a family with sequence similarity 172 member A) (against the n terminal of 1110033M05Rik) (50??µg) mouse
(Aviva Systems Biology Cat# ARP37639_P050, RRID:AB_10714430)
polyclonal antibody
manufacturer recommendations: WB
rabbit
Aviva Systems Biology
ARP37639_P050
Anti-1110033M05RIK, (N-terminal) antibody produced in rabbit
1110033M05RIK (N-terminal) antibody produced in rabbit mouse
(Sigma-Aldrich Cat# SAB2105402, RRID:AB_10742419)
polyclonal antibody
Vendor recommendations: immunoblotting: suitable; Western Blot
rabbit
Sigma-Aldrich
SAB2105402
1110033M05Rik antibody
1110033M05Rik antibody mouse
(Abcam Cat# ab104404, RRID:AB_10712297)
polyclonal antibody
validation status unknown, seller recommendations provided in 2012: Western Blot; WB
rabbit
Abcam
ab104404
Anti-1110033M05RIK antibody produced in rabbit
1110033M05RIK antibody produced in rabbit mouse
(Sigma-Aldrich Cat# AV37640, RRID:AB_1844329)
polyclonal antibody
Vendor recommendations: immunohistochemistry: suitable, immunoblotting: suitable; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
AV37640