Showing 101 - 120 results out of 2,479,116 with the query:
*
with sorting:
Target Antigen Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Anti-MARCH10 antibody
10-Mar epitope: LPDRESATEKDRGGSENAKKSPLSWDTKSEPRQEVGVNAENVWSDCISVEHRPGTHDSEGYWKDYLNSSQNSLDYFISGRPISPRSSVNSSYNPPAS See NCBI gene human
(Atlas Antibodies Cat# HPA023322, RRID:AB_1856351)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA023322
Mouse Anti-Human SEPT10 Monoclonal Antibody
10-Sep human
(Creative Diagnostics Cat# CABT-35948MH, RRID:AB_2356883)
monoclonal antibody
144
mouse
Creative Diagnostics
CABT-35948MH
Anti-SEPT10 antibody
10-Sep epitope: LLEEEIIAFSKKKATSEIFHSQSFLATGSNLRKDKDRKNSNF See NCBI gene human
(Atlas Antibodies Cat# HPA060310, RRID:AB_2684249)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA060310
Anti-SEPT10 antibody
10-Sep epitope: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG See NCBI gene human
(Atlas Antibodies Cat# HPA047860, RRID:AB_2680187)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA047860
Anti-SEPT10 antibody
10-Sep epitope: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVG See NCBI gene human
(Atlas Antibodies Cat# HPA056304, RRID:AB_2683094)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA056304
Anti-1100001H23RIK, (N-terminal) antibody produced in rabbit
1100001H23RIK (N-terminal) antibody produced in rabbit mouse
(Sigma-Aldrich Cat# SAB2105345, RRID:AB_10740451)
polyclonal antibody
Vendor recommendations: Western Blot; immunoblotting: suitable
rabbit
Sigma-Aldrich
SAB2105345
1100001H23Rik (phospholipase B domain containing 1) Antibody (against the n terminal of 1100001H23Rik)(50ug)
1100001H23Rik (phospholipase B domain containing 1) (against the n terminal of 1100001H23Rik)(50ug) mouse
(Aviva Systems Biology Cat# ARP37350_P050, RRID:AB_10714817)
polyclonal antibody
manufacturer recommendations: WB,DT
rabbit
Aviva Systems Biology
ARP37350_P050
1110033M05RIK Antibody
1110033M05RIK mouse, m
(ProSci Cat# 28-711, RRID:AB_10908548)
unknown
manufacturer recommendations: ELISA; Western Blot; 1110033M05RIK antibody can be used for detection of 1110033M05RIK by ELISA at 1:312500. 1110033M05RIK antibody can be used for detection of 1110033M05RIK by western blot at 0.5 & 956;g/mL, and HRP conjugated secondary antibody should be diluted 1:50,000 - 100,000. E, WB
rabbit
ProSci
28-711
1110033M05RIK Antibody (against the N terminal of 1110033M05RIK) (50ug)
1110033M05RIK (against the N terminal of 1110033M05RIK) (50ug) mouse
(Aviva Systems Biology Cat# ARP37640_P050, RRID:AB_593075)
polyclonal antibody
manufacturer recommendations: IgG WB; Western Blot; ELISA
rabbit
Aviva Systems Biology
ARP37640_P050
1110033M05Rik (Fam172a family with sequence similarity 172, member A) Antibody (against the n terminal of 1110033M05Rik) (50??µg)
1110033M05Rik (Fam172a family with sequence similarity 172 member A) (against the n terminal of 1110033M05Rik) (50??µg) mouse
(Aviva Systems Biology Cat# ARP37639_P050, RRID:AB_10714430)
polyclonal antibody
manufacturer recommendations: WB
rabbit
Aviva Systems Biology
ARP37639_P050
Anti-1110033M05RIK, (N-terminal) antibody produced in rabbit
1110033M05RIK (N-terminal) antibody produced in rabbit mouse
(Sigma-Aldrich Cat# SAB2105402, RRID:AB_10742419)
polyclonal antibody
Vendor recommendations: immunoblotting: suitable; Western Blot
rabbit
Sigma-Aldrich
SAB2105402
1110033M05Rik antibody
1110033M05Rik antibody mouse
(Abcam Cat# ab104404, RRID:AB_10712297)
polyclonal antibody
validation status unknown, seller recommendations provided in 2012: Western Blot; WB
rabbit
Abcam
ab104404
Anti-1110033M05RIK antibody produced in rabbit
1110033M05RIK antibody produced in rabbit mouse
(Sigma-Aldrich Cat# AV37640, RRID:AB_1844329)
polyclonal antibody
Vendor recommendations: immunohistochemistry: suitable, immunoblotting: suitable; Western Blot; Immunohistochemistry
rabbit
Sigma-Aldrich
AV37640
1110051B16RIK Antibody
1110051B16RIK m, mouse
(ProSci Cat# 28-702, RRID:AB_10905293)
unknown
manufacturer recommendations: Western Blot; ELISA; E, WB 1110051B16RIK antibody can be used for detection of 1110051B16RIK by ELISA at 1:1562500. 1110051B16RIK antibody can be used for detection of 1110051B16RIK by western blot at 0.125 & 956;g/mL, and HRP conjugated secondary antibody should be diluted 1:50,000 - 100,000.
rabbit
ProSci
28-702
1110051B16RIK Antibody (against the C terminal of 1110051B16RIK) (50ug)
1110051B16RIK (against the C terminal of 1110051B16RIK) (50ug) mouse
(Aviva Systems Biology Cat# ARP37608_P050, RRID:AB_593077)
polyclonal antibody
manufacturer recommendations: IgG Western Blot; WB; ELISA
rabbit
Aviva Systems Biology
ARP37608_P050
1110051B16RIK antibody
1110051B16RIK antibody mouse
(Fitzgerald Industries International Cat# 70R-8213, RRID:AB_11198053)
polyclonal antibody
manufacturer recommendations: Western Blot; WB
rabbit
Fitzgerald Industries International
70R-8213
Anti-1110051B16RIK antibody produced in rabbit
1110051B16RIK antibody produced in rabbit mouse
(Sigma-Aldrich Cat# AV37608, RRID:AB_1844330)
polyclonal antibody
Vendor recommendations: Western Blot; immunoblotting: suitable
rabbit
Sigma-Aldrich
AV37608
Anti-1110058L19Rik antibody
1110058L19Rik mouse
(LifeSpan Cat# LS-C148742-100, RRID:AB_11131062)
polyclonal antibody
vendor suggested use: Western Blot; WB (5 - 10 µg/ml)
rabbit
LifeSpan
LS-C148742-100
1110059E24Rik Polyclonal Antibody
1110059E24Rik bovine, canine, equine, guinea pig, human, mouse, porcine, rabbit, rat
(Thermo Fisher Scientific Cat# PA5-69956, RRID:AB_2690223)
polyclonal antibody
Applications: WB (1.0 µg/mL)
rabbit
Thermo Fisher Scientific Go To Vendor
PA5-69956
Anti-1110059E24Rik antibody
1110059E24Rik human, mouse
(LifeSpan Cat# LS-C145981-50, RRID:AB_10966617)
polyclonal antibody
vendor suggested use: Western Blot; WB
rabbit
LifeSpan
LS-C145981-50