Showing 1 - 7 results out of 7 with the query:
with facets:
Host Organism:balb X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clone ID
Cat Num
6B8 antibody
the peptide (C3) of Cterminus of PCV2b CP epitope: P59, KDPPLNP; P67, DPPLNPK
(Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan Cat# 12-Hung-10 m&18ORF233 6B8, RRID:AB_2629445)
monoclonal antibody
Detection of PCV2b-1A/1B and PCV2b-1C by Western blot assay, indirect immunofluorescence staining, and indirect ELISA. The core motif (P62) within the P59 could be recognized by mAbs (6B8) in the free status by liquid phase blocking immunoassay (LPBI) but not be recognized by these mAbs in the fixed form on the plate by indirect ELISA (iELISA).
balb, cbyjnarl mouse
Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan
12-Hung-10 m&18ORF233 6B8
3B2 antibody
the peptide (C3) of Cterminus of PCV2b CP epitope: P59, KDPPLNP
(Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan Cat# 12-Hung-10 m&18ORF233 3B2, RRID:AB_2629444)
monoclonal antibody
Detection of PCV2b-1A/1B by Western blot assay, indirect immunofluorescence staining, and indirect ELISA. The core motif (P62) within the P59 could be recognized by mAbs (3B2) in the free status by liquid phase blocking immunoassay (LPBI) but not be recognized by these mAbs in the fixed form on the plate by indirect ELISA (iELISA).
balb, cbyjnarl mouse
Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan
12-Hung-10 m&18ORF233 3B2
1H3 antibody
the peptide (C3) of Cterminus of PCV2b CP epitope: P62, DPPLNP; P67, DPPLNPK; P73, LKDPPLKP
(Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan Cat# 12-Hung-10 m&18ORF233 1H3, RRID:AB_2629214)
monoclonal antibody
Detection of PCV2b-1A/1B and PCV2b-1C by Western blot assay, indirect immunofluorescence staining, and indirect ELISA. The P73 could be recognized by mAb 1H3 by iELISA but no inhibition of the interactive binding of C3 and mAb 1H3 by LPBI.
balb, cbyjnarl mouse
Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan
12-Hung-10 m&18ORF233 1H3
Anti-VP1 antibody
RRV VP1 epitope: aa 227 to 539 rhesus rotavirus rrv
(Grupo de la Dra. Susana Lopez; Instituto de Biotecnologia, UNAM. Cat# mouse polyclonal VP1, RRID:AB_2802095)
polyclonal antibody
balb, c mice
Grupo de la Dra. Susana Lopez; Instituto de Biotecnologia, UNAM.
mouse polyclonal VP1
6D10 antibody
the peptide (N1) of Nterminus of PCV2b ORF3 protein epitope: N1, CHNDVYISLPITLLHFPAHFQKFSQPAEISDKR pcv2b
(Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan Cat# 12-Hung-03 m& 20 ORF3 6D10, RRID:AB_2827542)
monoclonal antibody
broad binding, moderate specificity, and low affinity with associated peptides.
balb, cbyjnarl mouse
Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan
12-Hung-03 m& 20 ORF3 6D10
8A3 antibody
the peptide (C3) of Cterminus of PCV2b CP epitope: C3, CHVGLGTAFENSIYDQEYNIRVTMYVQFREFNLKDPPLNP pcv2b
(Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan Cat# 12-Hung-10 m&18ORF233 8A3, RRID:AB_2827540)
monoclonal antibody
Detection of linear peptide C3 by indirect ELISA.
balb, cbyjnarl mouse
Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan
12-Hung-10 m&18ORF233 8A3
7D3 antibody
the peptide (N1) of Nterminus of PCV2b ORF3 protein epitope: P126, HNDVYISLPITLLHFPAHFQKFSQPAEISDKR pcv2b
(Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan Cat# 12-Hung-03 m& 20 ORF3 7D3, RRID:AB_2827541)
monoclonal antibody
Detection of PCV2b-1A/1B by indirect immunofluorescence staining and indirect ELISA. Free thiol residues on the antigen-binding sites of mAb 7D3.
balb, cbyjnarl mouse
Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan
12-Hung-03 m& 20 ORF3 7D3