Showing 1 - 20 results out of 147 with the query:
*
with facets:
Host Organism:c X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
376FN1 antibody
phosphocholine null
(Bernhard Guggenheim, Institute of Oral Microbiology and General Immunology, University of Zurich, Zurich, Switzerland Cat# 376FN1, RRID:AB_2341119)
monoclonal antibody
cataloged by IEDB
mus musculus balb, c
Bernhard Guggenheim, Institute of Oral Microbiology and General Immunology, University of Zurich, Zurich, Switzerland
376FN1
376FN1 antibody
null
(Bernhard Guggenheim, Institute of Oral Microbiology and General Immunology, University of Zurich, Zurich, Switzerland Cat# 376FN1-Streptococcus pneumoniae WU2 and ATCC 49619, RRID:AB_2341117)
monoclonal antibody
cataloged by IEDB
mus musculus balb, c
Bernhard Guggenheim, Institute of Oral Microbiology and General Immunology, University of Zurich, Zurich, Switzerland
376FN1-Streptococcus pneumoniae WU2 and ATCC 49619
Fab-12 variant Y0317 antibody
VEGF homodimer human
(imported from the IEDB Cat# Fab-12 variant Y0317, RRID:AB_2619696)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
Fab-12 variant Y0317
26-2F antibody
Angiogenin precursor human
(imported from the IEDB Cat# 26-2F, RRID:AB_2619692)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
26-2F
Anti-Procalcitonin (MOUSE) Monoclonal Antibody - 200-301-I47S
Procalcitonin (9D9.E11.C3.E8.F4.D4) Antibody human
(Rockland Cat# 200-301-I47S, RRID:AB_2611333)
monoclonal antibody
ELISA,Western Blot, Anti-Procalcitonin antibody is suitbale for use in ELISA and Western Blot
9D9.E11.C3.E8.F4.D4
mouse balb, c
Rockland
200-301-I47S
Anti-Procalcitonin (MOUSE) Monoclonal Antibody - 200-301-I38
Procalcitonin (4C8.H6.D4) Antibody human
(Rockland Cat# 200-301-I38, RRID:AB_2611314)
monoclonal antibody
ELISA,Western Blot, Anti-Procalcitonin antibody is suitbale for use in ELISA and Western Blot
4C8.H6.D4
mouse balb, c
Rockland
200-301-I38
Anti-Procalcitonin (MOUSE) Monoclonal Antibody - 200-301-I38S
Procalcitonin (4C8.H6.D4) Antibody human
(Rockland Cat# 200-301-I38S, RRID:AB_2611315)
monoclonal antibody
ELISA,Western Blot, Anti-Procalcitonin antibody is suitbale for use in ELISA and Western Blot
4C8.H6.D4
mouse balb, c
Rockland
200-301-I38S
Anti-Procalcitonin (MOUSE) Monoclonal Antibody - 200-301-I42
Procalcitonin (9G4.C3.F2) Antibody human
(Rockland Cat# 200-301-I42, RRID:AB_2611322)
monoclonal antibody
ELISA,Western Blot, Anti-Procalcitonin antibody is suitbale for use in ELISA and Western Blot
9G4.C3.F2
mouse balb, c
Rockland
200-301-I42
Anti-Procalcitonin (MOUSE) Monoclonal Antibody - 200-301-I46
Procalcitonin (8G10.H3.C3.G4.E2.C8) Antibody human
(Rockland Cat# 200-301-I46, RRID:AB_2611330)
monoclonal antibody
ELISA,Western Blot, Anti-Procalcitonin antibody is suitable for use in ELISA and Western Blot
8G10.H3.C3.G4.E2.C8
mouse balb, c
Rockland
200-301-I46
Anti-Procalcitonin (MOUSE) Monoclonal Antibody - 200-301-I48S
Procalcitonin (4D12.D4.F3.E2.H7.E7) Antibody human
(Rockland Cat# 200-301-I48S, RRID:AB_2611335)
monoclonal antibody
ELISA,Western Blot, Anti-Procalcitonin antibody is suitbale for use in ELISA and Western Blot
4D12.D4.F3.E2.H7.E7
mouse balb, c
Rockland
200-301-I48S
Anti-Procalcitonin (MOUSE) Monoclonal Antibody - 200-301-I50S
Procalcitonin (22C1.C7.C6.B8.B7.G8) Antibody human
(Rockland Cat# 200-301-I50S, RRID:AB_2611339)
monoclonal antibody
ELISA,Western Blot, Anti-Procalcitonin antibody is suitbale for use in ELISA and Western Blot
22C1.C7.C6.B8.B7.G8
mouse balb, c
Rockland
200-301-I50S
UCHT1 antibody
T-cell surface glycoprotein CD3 epsilon chain precursor human
(imported from the IEDB Cat# UCHT1, RRID:AB_2619695)
monoclonal antibody
This antibody is a heavylight chain scFv.
mouse balb, c
imported from the IEDB Go To Vendor
UCHT1
A6 antibody
Interferon-gamma receptor alpha chain precursor human
(imported from the IEDB Cat# A6, RRID:AB_2619699)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
A6
Mouse Balb/C Anti-Helicobacter pylori Monoclonal Antibody, Unconjugated, Clone 3/15/45/2
Helicobacter pylori
(Immundiagnostik Cat# A 1013.1, RRID:AB_769920)
monoclonal antibody
manufacturer recommendations: ELISA; ELISA
Clone 3/15/45/2
mouse balb, c
Immundiagnostik
A 1013.1
Mouse Balb/C Anti-Geodia cydonium Aggregation Factor Monoclonal Antibody, Unconjugated, Clone 1D2
Geodia cydonium Aggregation Factor
(Immundiagnostik Cat# AC1001.1, RRID:AB_770004)
monoclonal antibody
manufacturer recommendations: ELISA; Immunohistochemistry; Immunoprecipitation; Western Blot; ELISA, Western Blot, Immunoprecipitation, Immunohistochemistry
Clone 1D2
mouse balb, c
Immundiagnostik
AC1001.1
Mouse Balb/C Anti-Geodia cydonium Aggregation Factor Monoclonal Antibody, Unconjugated, Clone 1D2
Geodia cydonium Aggregation Factor
(Immundiagnostik Cat# AC1001.2, RRID:AB_770005)
monoclonal antibody
manufacturer recommendations: ELISA; Immunohistochemistry; Immunoprecipitation; Western Blot; ELISA, Western Blot, Immunoprecipitation, Immunohistochemistry
Clone 1D2
mouse balb, c
Immundiagnostik
AC1001.2
Mouse Balb/C Anti-Geodia cydonium receptor Tyrosine Kinase Monoclonal Antibody, Unconjugated, Clone IVF6
Geodia cydonium receptor Tyrosine Kinase
(Immundiagnostik Cat# AC1014.2, RRID:AB_770045)
monoclonal antibody
manufacturer recommendations: ELISA; Immunohistochemistry; Immunoprecipitation; Western Blot; ELISA, Western Blot, Immunohistochemistry , Immunoprecipitation
Clone IVF6
mouse balb, c
Immundiagnostik
AC1014.2
Mouse Balb/C Anti-Geodia cydonium SRCR (Scavenger Receptor, Cysteine-Rich Domain) Monoclonal Antibody, Unconjugated, Clone 5F10
Geodia cydonium SRCR (Scavenger Receptor, Cysteine-Rich Domain)
(Immundiagnostik Cat# AC1013.2, RRID:AB_770051)
monoclonal antibody
manufacturer recommendations: ELISA; Immunohistochemistry; Immunoprecipitation; Western Blot; ELISA, Western Blot, Immunohistochemistry , Immunoprecipitation
Clone 5F10
mouse balb, c
Immundiagnostik
AC1013.2
OKT3 antibody
T-cell surface glycoprotein CD3 epsilon chain precursor human
(imported from the IEDB Cat# OKT3, RRID:AB_2619696)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
OKT3
BION-1 antibody
IQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSK human
(imported from the IEDB Cat# BION-1, RRID:AB_2619704)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
BION-1