Showing 1 - 19 results out of 19 with the query:
*
with facets:
Host Organism:rabbit X
Clonality:oligoclonal antibody X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
PRAS40 Recombinant Polyclonal Antibody (4HCLC)
PRAS40 human
(Thermo Fisher Scientific Cat# 710079, RRID:AB_2532548)
oligoclonal antibody
Discontinued: 2019; Applications: WB (1:100-1:1000)
Clone 4HCLC
rabbit
Thermo Fisher Scientific
710079
IL-13 Recombinant Polyclonal Antibody (21HCLC)
IL-13 mouse
(Thermo Fisher Scientific Cat# 710172, RRID:AB_2532602)
oligoclonal antibody
Discontinued: 2019; Applications: ELISA (1 µg/mL)
Clone 21HCLC
rabbit
Thermo Fisher Scientific
710172
JAM1 / CD321 Antibody (22HCLC), ABfinity
JAM1 / CD321 human
(Thermo Fisher Scientific Cat# 710302, RRID:AB_2532676)
oligoclonal antibody
Discontinued: 2016; Applications: Immunocytochemistry (1-2 ug/ml), Immunofluorescence (1-2 ug/ml); Reactive Species: Human
22HCLC
rabbit
Thermo Fisher Scientific
710302
IL-34 Recombinant Polyclonal Antibody (2HCLC)
IL-34 human
(Thermo Fisher Scientific Cat# 710114, RRID:AB_2532570)
oligoclonal antibody
Discontinued: 2019; Applications: WB (1-3 µg/mL)
Clone 2HCLC
rabbit
Thermo Fisher Scientific
710114
IL-9 Recombinant Polyclonal Antibody (2HCLC)
IL-9 human
(Thermo Fisher Scientific Cat# 710253, RRID:AB_2532645)
oligoclonal antibody
Discontinued: 2019; Applications: WB (1-2 µg/mL)
Clone 2HCLC
rabbit
Thermo Fisher Scientific
710253
CXCL2 Recombinant Polyclonal Antibody (16HCLC)
CXCL2 rat
(Thermo Fisher Scientific Cat# 710153, RRID:AB_2532595)
oligoclonal antibody
Discontinued: 2019; Applications: WB (1-3 µg/mL)
Clone 16HCLC
rabbit
Thermo Fisher Scientific
710153
IL-12 p40 Recombinant Polyclonal Antibody (21HCLC)
IL-12 p40 human
(Thermo Fisher Scientific Cat# 710257, RRID:AB_2532648)
oligoclonal antibody
Discontinued: 2019; Applications: WB (1-3 µg/mL)
Clone 21HCLC
rabbit
Thermo Fisher Scientific
710257
IL-8 (CXCL8) Recombinant Polyclonal Antibody (19HCLC)
IL-8 (CXCL8) porcine
(Thermo Fisher Scientific Cat# 710371, RRID:AB_2532698)
oligoclonal antibody
Discontinued: 2019; Applications: WB (0.1-2 µg/mL)
Clone 19HCLC
rabbit
Thermo Fisher Scientific
710371
CXCL9 Recombinant Polyclonal Antibody (11HCLC)
CXCL9 human
(Thermo Fisher Scientific Cat# 710147, RRID:AB_2532589)
oligoclonal antibody
Discontinued: 2019; Applications: WB (1-3 µg/mL)
Clone 11HCLC
rabbit
Thermo Fisher Scientific
710147
PAI1 Recombinant Polyclonal Antibody (6HCLC)
PAI1 human
(Thermo Fisher Scientific Cat# 710121, RRID:AB_2532574)
oligoclonal antibody
Discontinued: 2019; Applications: ELISA (Assay-Dependent)
Clone 6HCLC
rabbit
Thermo Fisher Scientific
710121
JLV-1 antibody
Rodent kisspeptin-52 epitope: TSPCPPVENPTGHQRPPCATRSRLIPAPRGSVLVQREKDMSAYNWNSFGLRY-NH2
(Mikkelsen Lab Copenhagen University Hospital Cat# JLV-1, RRID:AB_2631061)
oligoclonal antibody
J. Mikkelsen; Rigshospitalet; Copenhagen University Hospital; Denmark
rabbit
Mikkelsen Lab Copenhagen University Hospital
JLV-1
CCL4 Recombinant Polyclonal Antibody (C4HCLC)
CCL4 mouse
(Thermo Fisher Scientific Cat# 710016, RRID:AB_2532528)
oligoclonal antibody
Discontinued: 2019; Applications: WB (4-5 µg/mL)
Clone C4HCLC
rabbit
Thermo Fisher Scientific
710016
PINK1 Antibody (17HCLC), ABfinity(TM) Rabbit Oligoclonal
PINK1 human
(Thermo Fisher Scientific Cat# 710993, RRID:AB_2633104)
oligoclonal antibody
Discontinued; Applications: WB (1-2 µg/mL), IF (2 µg/mL)
Clone 17HCLC
rabbit
Thermo Fisher Scientific
710993
Phospho-GSK3 beta (Ser9) Antibody (9HCLC), ABfinity(TM) Rabbit Oligoclonal
Phospho-GSK3 beta (Ser9) human
(Thermo Fisher Scientific Cat# 710100, RRID:AB_2532563)
oligoclonal antibody
Discontinued: 2017; Vendor recommended applications: IF (1:100-1:1000), ICC (1:100-1:1000), WB (1:500-1:5000), ChIP (1 ul)
9HCLC
rabbit
Thermo Fisher Scientific
710100
Phospho-Rb (Ser249, Thr252) Antibody (7HCLC), ABfinity(TM) Rabbit Oligoclonal
Phospho-Rb (Ser249, Thr252) human
(Thermo Fisher Scientific Cat# 710090, RRID:AB_2532556)
oligoclonal antibody
Discontinued; Applications: WB (2-5 µg/mL)
Clone 7HCLC
rabbit
Thermo Fisher Scientific
710090
MCP-3 Recombinant Polyclonal Antibody (3HCLC)
MCP-3 human
(Thermo Fisher Scientific Cat# 710113, RRID:AB_2532569)
oligoclonal antibody
Discontinued: 2019; Applications: WB (1-3 µg/mL)
Clone 3HCLC
rabbit
Thermo Fisher Scientific
710113
CD146 Recombinant Polyclonal Antibody (2HCLC)
CD146 human
(Thermo Fisher Scientific Cat# 710230, RRID:AB_2532639)
oligoclonal antibody
Discontinued: 2019; Applications: WB (1-3 µg/mL)
Clone 2HCLC
rabbit
Thermo Fisher Scientific
710230
Phospho-IGF-IR pTyr1135+1136 Antibody (15HCLC), ABfinity Rabbit Oligoclonal
Phospho-IGF-IR pTyr1135+1136 human
(Thermo Fisher Scientific Cat# 710098, RRID:AB_2532561)
oligoclonal antibody
Discontinued; Applications: ELISA (Assay-Dependent); WB (1-3 ug/ml); Reactive Species: Human
15HCLC
rabbit
Thermo Fisher Scientific
710098
Phospho-MEK1 (Ser217, Ser221) Recombinant Polyclonal Antibody (13HCLCP)
Phospho-MEK1 (Ser217, Ser221) human
(Thermo Fisher Scientific Cat# 710291, RRID:AB_2532668)
oligoclonal antibody
Discontinued: 2019; Applications: WB (1-3 µg/mL)
Clone 13HCLCP
rabbit
Thermo Fisher Scientific
710291