Showing 1 - 20 results out of 143,290 with the query:
*
with facets:
Vendor:Abcam X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Anti-PI 3 Kinase Class 2A/Cpk antibody
PI 3 Kinase Class 2A/Cpk epitope: aa 1624-1686: C terminal - LQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLTAATYL human
(Abcam Cat# ab154583, RRID:AB_2861168)
polyclonal antibody
Applications: WB, ICC/IF
rabbit
Abcam
ab154583
Anti-CD163 antibody
CD163 human, mouse, rat
(Abcam Cat# ab182422, RRID:AB_2753196)
monoclonal antibody
Applications: Flow Cyt, IHC-P, WB, IHC-Fr
EPR19518
rabbit
Abcam
ab182422
Recombinant Anti-ABCE1 antibody [EPR15373(B)] - C-terminal
ABCE1 human, mouse, rat
(Abcam Cat# ab185548, RRID:AB_2858278)
recombinant antibody
Applications: ICC/IF, IP, WB, IHC-P, Flow Cyt
rabbit
Abcam
ab185548
Anti-alpha Synuclein antibody [MJFR1]
alpha Synuclein epitope: amino acids 118-123 (VDPDNE)
(Abcam Cat# ab138501, RRID:AB_2537217)
monoclonal antibody
MJFR1
rabbit
Abcam
ab138501
Biotinylated Goat Anti-Rabbit IgG (H+L) (Ready to use) (ab64256) antibody
IgG
(Abcam Cat# ab64256, RRID:AB_2661852)
polyclonal antibody
goat
Abcam
ab64256
KDM4B antibody
KDM4B human, mouse, rat
(Abcam Cat# ab191434, RRID:AB_2721242)
monoclonal antibody
suggested use: WB, IHC-P, ICC/IF, Flow Cyt
EPR18603
rabbit
Abcam
ab191434
Anti-GAP43 antibody
GAP43 mouse
(Abcam Cat# ab134019, RRID:AB_2721165)
polyclonal antibody
Applications: IHC-P, ICC, WB.
Armelin-Correa LM et al. Nuclear compartmentalization of odorant receptor genes. Proc Natl Acad Sci U S A 111:2782-7 (2014).
chicken
Abcam
ab134019
Anti-Histone H3 (tri methyl K27) antibody - ChIP Grade
Histone H3 (tri methyl K27) mouse
(Abcam Cat# ab195477, RRID:AB_2819023)
polyclonal antibody
Applications: WB, ICC/IF, Dot blot, ChIP, CHIPseq
rabbit
Abcam
ab195477
Slit1 antibody
Slit1 antibody human, mouse
(Abcam Cat# ab129345, RRID:AB_11156581)
polyclonal antibody
validation status unknown, seller recommendations provided in 2012: Immunohistochemistry; Immunohistochemistry - fixed; Western Blot; IHC-P, WB
rabbit
Abcam
ab129345
Mannosidase II antibody - Golgi Marker
Mannosidase II antibody - Golgi Marker non-human primate, human, monkey
(Abcam Cat# ab12277, RRID:AB_2139551)
polyclonal antibody
validation status unknown, seller recommendations provided in 2012: Immunocytochemistry; ICC
rabbit
Abcam
ab12277
beta Endorphin antibody [B31.15]
beta Endorphin antibody [B31.15] human
(Abcam Cat# ab1419, RRID:AB_300975)
monoclonal antibody
validation status unknown, seller recommendations provided in 2012: Immunohistochemistry - frozen; Immunohistochemistry; Immunofluorescence; IF, IHC-Fr
mouse
Abcam
ab1419
Anti-GFP antibody - ChIP Grade
GFP species independent
(Abcam Cat# ab290, RRID:AB_303395)
polyclonal antibody
PMID:20151419, PMID:22102059, PMID:22134929, PMID:23546600, PMID:23926259, PMID:24617526, PMID:25804740, PMID:26105993, PMID:26777275, PMID:27336723, PMID:27616678, PMID:27662089, PMID:27693354, PMID:27726418, PMID:27845622, PMID:27863209, PMID:28086087, PMID:28167673, PMID:28190767, PMID:28238551, PMID:28240595, PMID:28318821, PMID:28344080, PMID:28512996, PMID:28521134, PMID:28535371, PMID:28561735, PMID:28575661, PMID:28618269, PMID:28622508, PMID:28683263, PMID:28722652, PMID:28735746, PMID:28760862, PMID:28781048, PMID:28823561, PMID:28890335, PMID:28893254, PMID:28938454, PMID:29042259, PMID:29072575, PMID:29195810, PMID:29249285, PMID:29257953, PMID:29328919, PMID:29395789, PMID:29500189, PMID:29576527, PMID:29630493, PMID:29636436, PMID:29657031, PMID:29689192, PMID:29689199, PMID:29738710, PMID:29754754, PMID:29809133, PMID:29846170, PMID:29858554, PMID:29867082, PMID:29937354, PMID:29943833, PMID:30018294, PMID:30070637, PMID:30078561, PMID:30085028, PMID:30099545, PMID:30118681, PMID:30144320, PMID:30174180, PMID:30180933, PMID:30191603, PMID:30193095, PMID:30212650, PMID:30225352, PMID:30245011, PMID:30247619, PMID:30251625, PMID:30269950, PMID:30318442, PMID:30340022, PMID:30388410, PMID:30404010, PMID:30415924, PMID:30425164, PMID:30530860, PMID:30540930, PMID:30554943, PMID:30581142, PMID:30581152, PMID:30605688, PMID:30612742, PMID:30612879, PMID:30627638, PMID:30650349, PMID:30755492, PMID:30770245, PMID:30772082, PMID:30784582, PMID:30792151, PMID:30840897, PMID:30853402, PMID:30853441, PMID:30905608, PMID:30943403, PMID:30970241, PMID:30975460, PMID:30982652, PMID:30982665, PMID:31091448, PMID:31135340, PMID:31138685, PMID:31155350, PMID:31182187, PMID:31199242, PMID:31201215, PMID:31204999, PMID:31242423, PMID:31318984, PMID:31336098, PMID:31378567, PMID:31509428, PMID:31533632, PMID:31543461, PMID:31573510, PMID:31590942, PMID:31679819, PMID:31693882, PMID:31708432, PMID:31722427, PMID:31731181, PMID:31744842, PMID:31759821, PMID:31813625, PMID:31866147, PMID:31866202, PMID:31883789, PMID:31883795, PMID:31907278, PMID:32065581, PMID:32111743, PMID:32293562, PMID:32343840, PMID:32344433
Applications: Flow Cyt, ELISA, ICC/IF, ChIP, IHC-FrFl, ChIP/Chip, IHC - Wholemount, Electron Microscopy, IHC-FoFr, ICC, IHC-P, IHC-Fr, IP, WB
rabbit
Abcam
ab290
PCNA antibody - Proliferation Marker
PCNA antibody - Proliferation Marker hamster, human, non-human primate, mouse, rat, canine, zebrafish/fish, human, mouse, rat, apteronotus leptorhynchus, dog, hamster, marmoset (common), zebrafish
(Abcam Cat# ab2426, RRID:AB_303062)
polyclonal antibody
validation status unknown, seller recommendations provided in 2012: Immunohistochemistry - frozen; Immunohistochemistry; Immunocytochemistry; Immunohistochemistry - fixed; Western Blot; Immunofluorescence; Immunoprecipitation; ICC/IF, IHC-Fr, IHC-P, IP, WB
rabbit
Abcam
ab2426
Cleaved PARP antibody
Cleaved PARP antibody human
(Abcam Cat# ab2317, RRID:AB_302973)
polyclonal antibody
validation status unknown, seller recommendations provided in 2012: Immunocytochemistry; Immunofluorescence; Immunohistochemistry; Western Blot; ICC/IF, WB
rabbit
Abcam
ab2317
Catalase antibody - Peroxisome Marker
Catalase antibody - Peroxisome Marker human, mouse, rat, chicken, cow, sheep, rat, sheep, human, chicken/bird, bovine, mouse
(Abcam Cat# ab1877, RRID:AB_302649)
polyclonal antibody
validation status unknown, seller recommendations provided in 2012: Immunohistochemistry - fixed; Immunofluorescence; ELISA; Immunohistochemistry; Immunohistochemistry - frozen; Immunoprecipitation; Western Blot; Immunocytochemistry; ELISA, ICC, ICC/IF, IHC-Fr, IHC-P, IP, WB
rabbit
Abcam
ab1877
CCR1 antibody - F(ab)2 Fragment
CCR1 antibody - F(ab)2 Fragment null
(Abcam Cat# ab1681, RRID:AB_10065510)
monoclonal antibody
validation status unknown, seller recommendations provided in 2012: ELISA; Immunocytochemistry; Immunofluorescence; Immunohistochemistry - fixed; Immunohistochemistry; Western Blot; ELISA, ICC, ICC/IF, IHC-P, WB
rabbit
Abcam
ab1681
CCR5 antibody
CCR5 antibody null
(Abcam Cat# ab1673, RRID:AB_10065533)
monoclonal antibody
validation status unknown, seller recommendations provided in 2012: ICC, IHC-Fr, IHC-P, WB; Immunohistochemistry; Immunocytochemistry; Western Blot; ELISA; Immunohistochemistry - frozen; Immunohistochemistry - fixed
goat
Abcam
ab1673
Dystrophin antibody
Dystrophin antibody human, mouse, dog, human, mouse, canine
(Abcam Cat# ab15277, RRID:AB_301813)
polyclonal antibody
validation status unknown, seller recommendations provided in 2012: ICC/IF, IHC-Fr, IHC-P, WB; Western Blot; Immunohistochemistry; Immunohistochemistry - frozen; Immunofluorescence; Immunocytochemistry; Immunohistochemistry - fixed
rabbit
Abcam
ab15277
Metabotropic Glutamate Receptor 2 antibody [mG2Na-s]
Metabotropic Glutamate Receptor 2 antibody [mG2Na-s] mouse, rat, human, mouse, rat
(Abcam Cat# ab15672, RRID:AB_302021)
monoclonal antibody
validation status unknown, seller recommendations provided in 2012: Immunohistochemistry - frozen; Immunofluorescence; Immunohistochemistry; Western Blot; IF, IHC-FoFr, IHC-Fr, WB
mouse
Abcam
ab15672
Calbindin antibody - Neuronal Marker
Calbindin antibody - Neuronal Marker human, mouse, rat, mouse, rat, human
(Abcam Cat# ab11426, RRID:AB_298031)
polyclonal antibody
validation status unknown, seller recommendations provided in 2012: ELISA, ICC/IF, IF, IHC-Fr, IHC-P, IP, WB; Immunocytochemistry; Immunofluorescence; ELISA; Immunohistochemistry - frozen; Immunohistochemistry - fixed; Immunohistochemistry; Immunoprecipitation; Other; Western Blot
rabbit
Abcam
ab11426