Showing 1 - 2 results out of 2 with the query:
AB_10601445
with sorting:
Clone ID Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-OGT antibody produced in rabbit
OGT antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA030752, RRID:AB_10601445)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA030752
Anti-OGT polyclonal antibody Go To Vendor
OGT epitope: NMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATT See NCBI gene human
(Atlas Antibodies Cat# HPA030752, RRID:AB_10601445)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA030752