Showing 1 - 2 results out of 2 with the query:
AB_10601491
with sorting:
Reference Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-PRKACB antibody produced in rabbit
PRKACB antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA029754, RRID:AB_10601491)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA029754
Anti-PRKACB polyclonal antibody Go To Vendor
PRKACB epitope: MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWDRSMKEFLAKAKEDFLKKWENPTQNNAGLEDFER See NCBI gene human
(Atlas Antibodies Cat# HPA029754, RRID:AB_10601491)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA029754