Showing 1 - 2 results out of 2 with the query:
AB_10601715
with sorting:
Target Antigen Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-SLC25A39 antibody produced in rabbit
SLC25A39 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA026785, RRID:AB_10601715)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA026785
Anti-SLC25A39 polyclonal antibody Go To Vendor
SLC25A39 epitope: RLQSQRPSMASELMPSSRLWSLSYTKWKCLLYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGTRTL See NCBI gene human
(Atlas Antibodies Cat# HPA026785, RRID:AB_10601715)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA026785