Showing 1 - 2 results out of 2 with the query:
AB_10602246
with sorting:
Clonality Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-RRM2B polyclonal antibody Go To Vendor
RRM2B epitope: MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV See NCBI gene human
(Atlas Antibodies Cat# HPA028812, RRID:AB_10602246)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA028812
Anti-RRM2B antibody produced in rabbit
RRM2B antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA028812, RRID:AB_10602246)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA028812