Showing 1 - 2 results out of 2 with the query:
AB_10671527
with sorting:
Proper Citation Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-RPAP3 antibody Go To Vendor
RPAP3 epitope: SEKMPIEIEQKPAQFATTVLPPIPANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHDFYIEKEKPLLIFEILQRLSELKRFDMAVMFM See NCBI gene human
(Atlas Antibodies Cat# HPA038311, RRID:AB_10671527)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA038311
Anti-RPAP3 antibody produced in rabbit
RPAP3 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA038311, RRID:AB_10671527)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA038311