Showing 1 - 2 results out of 2 with the query:
AB_10672863
with sorting:
Proper Citation Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-PPIL2 polyclonal antibody Go To Vendor
PPIL2 epitope: MENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGVGKYINPAATKRAAEEEPSTSATVPMSKKKPSRGFGDFSS See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA035344, RRID:AB_10672863)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA035344
Anti-PPIL2 antibody produced in rabbit
PPIL2 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA035344, RRID:AB_10672863)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA035344