Showing 1 - 2 results out of 2 with the query:
AB_10673291
with sorting:
Antibody Name Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-PSPC1 antibody produced in rabbit
PSPC1 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA038904, RRID:AB_10673291)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA038904
Anti-PSPC1 polyclonal antibody Go To Vendor
PSPC1 epitope: PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA038904, RRID:AB_10673291)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA038904