Showing 1 - 2 results out of 2 with the query:
AB_10697715
with sorting:
Vendor Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-TMX2 polyclonal antibody Go To Vendor
TMX2 epitope: YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSP See NCBI gene human
(Atlas Antibodies Cat# HPA040282, RRID:AB_10697715)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA040282
Anti-TMX2 antibody produced in rabbit
TMX2 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA040282, RRID:AB_10697715)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA040282