Showing 1 - 3 results out of 3 with the query:
AB_1078739
with sorting:
Antibody Name Descending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-EMX1 polyclonal antibody Go To Vendor
EMX1 epitope: RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI See NCBI gene human, mouse
(Atlas Antibodies Cat# HPA006421, RRID:AB_1078739)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA006421
Anti-EMX1 antibody produced in rabbit
Human EMX1 human
(Sigma-Aldrich Cat# HPA006421, RRID:AB_1078739)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA006421
Anti-EMX1 antibody produced in rabbit
EMX1 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA006421, RRID:AB_1078739)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA006421