Showing 1 - 3 results out of 3 with the query:
AB_1078790
with sorting:
Comments Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-F12 polyclonal antibody Go To Vendor
F12 epitope: YHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDA See NCBI gene human
(Atlas Antibodies Cat# HPA003825, RRID:AB_1078790)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA003825
Anti-F12 antibody produced in rabbit
Human F12 human
(Sigma-Aldrich Cat# HPA003825, RRID:AB_1078790)
unknown
Vendor recommendations:
rabbit
Sigma-Aldrich
HPA003825
Anti-F12 antibody produced in rabbit
F12 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA003825, RRID:AB_1078790)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA003825