Showing 1 - 2 results out of 2 with the query:
AB_1079092
with facets:
Clonality:polyclonal antibody X
with sorting:
Antibody ID Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-TRMT2A antibody produced in rabbit
TRMT2A antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA001077, RRID:AB_1079092)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot; Immunofluorescence
rabbit
Sigma-Aldrich
HPA001077
Anti-TRMT2A polyclonal antibody
TRMT2A epitope: LCPEAVEDARVNAQDNELSNVEFHCGRAEDLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGT See NCBI gene human
(Atlas Antibodies Cat# HPA001077, RRID:AB_1079092)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA001077