Showing 1 - 2 results out of 2 with the query:
AB_10795144
with facets:
Host Organism:rabbit X
with sorting:
Vendor Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-KCNG1 polyclonal antibody
KCNG1 epitope: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFY See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA039530, RRID:AB_10795144)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA039530