Showing 1 - 3 results out of 3 with the query:
with sorting:
Antibody Name Descending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clone ID
Host Organism
Cat Num
Anti-B3GLCT polyclonal antibody Go To Vendor
(Atlas Antibodies Cat# HPA017664, RRID:AB_1845241)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TPVPEFCTNDVDFYCATTFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIV; Manufacturer approved use: IHC, WB
Atlas Antibodies
Anti-B3GALTL antibody produced in rabbit
B3GALTL antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017664, RRID:AB_1845241)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-B3GALTL antibody produced in rabbit
Human B3GALTL human
(Sigma-Aldrich Cat# HPA017664, RRID:AB_1845241)
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array