Showing 1 - 3 results out of 3 with the query:
AB_1845241
with sorting:
Proper Citation Descending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-B3GALTL antibody produced in rabbit
B3GALTL antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017664, RRID:AB_1845241)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA017664
Anti-B3GALTL antibody produced in rabbit
Human B3GALTL human
(Sigma-Aldrich Cat# HPA017664, RRID:AB_1845241)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA017664
Anti-B3GLCT polyclonal antibody Go To Vendor
B3GLCT epitope: TPVPEFCTNDVDFYCATTFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIV See NCBI gene human
(Atlas Antibodies Cat# HPA017664, RRID:AB_1845241)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TPVPEFCTNDVDFYCATTFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIV; Manufacturer approved use: IHC, WB
rabbit
Atlas Antibodies
HPA017664