Showing 1 - 3 results out of 3 with the query:
AB_1845760
with sorting:
Cat Num Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-C7orf57 antibody produced in rabbit
Human C7orf57 human
(Sigma-Aldrich Cat# HPA021286, RRID:AB_1845760)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA021286
Anti-C7orf57 antibody produced in rabbit
C7orf57 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA021286, RRID:AB_1845760)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA021286
Anti-C7orf57 polyclonal antibody Go To Vendor
C7orf57 epitope: ISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPGPEESVSASTPA See NCBI gene human
(Atlas Antibodies Cat# HPA021286, RRID:AB_1845760)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA021286