Showing 1 - 3 results out of 3 with the query:
AB_1845905
with sorting:
Reference Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CDH4 antibody produced in rabbit
CDH4 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA015613, RRID:AB_1845905)
polyclonal antibody
Vendor recommendations: Other; Immunofluorescence; Immunohistochemistry; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA015613
Anti-CDH4 antibody produced in rabbit
Human CDH4 human
(Sigma-Aldrich Cat# HPA015613, RRID:AB_1845905)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA015613
Anti-CDH4 Antibody Go To Vendor
CDH4 epitope: YLIDINDNAPELLPKEAQICERPNLNAINITAADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCD See NCBI gene human
(Atlas Antibodies Cat# HPA015613, RRID:AB_1845905)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Consolidation on 8/2020: AB_1845905, AB_2732414.
rabbit
Atlas Antibodies
HPA015613