Showing 1 - 3 results out of 3 with the query:
AB_1846379
with sorting:
Target Antigen Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-CDC5L antibody produced in rabbit
CDC5L antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA011361, RRID:AB_1846379)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Immunofluorescence; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA011361
Anti-CDC5L polyclonal antibody Go To Vendor
CDC5L epitope: GAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILR See NCBI gene human
(Atlas Antibodies Cat# HPA011361, RRID:AB_1846379)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA011361
Anti-CDC5L antibody produced in rabbit
Human CDC5L human
(Sigma-Aldrich Cat# HPA011361, RRID:AB_1846379)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA011361