Showing 1 - 3 results out of 3 with the query:
AB_1846597
with sorting:
Antibody ID Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-FAM164A antibody produced in rabbit
Human FAM164A human
(Sigma-Aldrich Cat# HPA024726, RRID:AB_1846597)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA024726
Anti-ZC2HC1A polyclonal antibody Go To Vendor
ZC2HC1A epitope: TYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL See NCBI gene human, rat, mouse
(Atlas Antibodies Cat# HPA024726, RRID:AB_1846597)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA024726
Anti-FAM164A antibody produced in rabbit
FAM164A antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA024726, RRID:AB_1846597)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA024726