Showing 1 - 3 results out of 3 with the query:
AB_1847649
with sorting:
Clone ID Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-DHODH antibody produced in rabbit
Human DHODH human
(Sigma-Aldrich Cat# HPA011942, RRID:AB_1847649)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA011942
Anti-DHODH antibody produced in rabbit
DHODH antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA011942, RRID:AB_1847649)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Other; Western Blot
rabbit
Sigma-Aldrich
HPA011942
Anti-DHODH polyclonal antibody
DHODH epitope: LAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRG See NCBI gene human
(Atlas Antibodies Cat# HPA011942, RRID:AB_1847649)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA011942