Showing 1 - 3 results out of 3 with the query:
AB_1852382
with sorting:
Comments Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-FAM208A polyclonal antibody Go To Vendor
FAM208A epitope: GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVYQKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNIQQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQNFKNLVGYHNSITEENLPQLGANENLES See NCBI gene human
(Atlas Antibodies Cat# HPA017142, RRID:AB_1852382)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA017142
Anti-C3orf63 antibody produced in rabbit
Human C3orf63 human
(Sigma-Aldrich Cat# HPA017142, RRID:AB_1852382)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA017142
Anti-C3orf63 antibody produced in rabbit
C3orf63 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017142, RRID:AB_1852382)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other
rabbit
Sigma-Aldrich
HPA017142