Showing 1 - 3 results out of 3 with the query:
AB_1857804
with sorting:
Reference Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-TBRG4 antibody produced in rabbit
TBRG4 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA020582, RRID:AB_1857804)
polyclonal antibody
Vendor recommendations: Other; Immunofluorescence; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA020582
Anti-TBRG4 antibody produced in rabbit
Human TBRG4 human
(Sigma-Aldrich Cat# HPA020582, RRID:AB_1857804)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA020582
Anti-TBRG4 antibody Go To Vendor
TBRG4 epitope: HLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHLIKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKP See NCBI gene human
(Atlas Antibodies Cat# HPA020582, RRID:AB_1857804)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA020582