Showing 1 - 3 results out of 3 with the query:
AB_1858656
with sorting:
Target Antigen Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-UTS2 antibody produced in rabbit
Human UTS2 human
(Sigma-Aldrich Cat# HPA017000, RRID:AB_1858656)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA017000
Anti-UTS2 antibody produced in rabbit
UTS2 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017000, RRID:AB_1858656)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA017000
Anti-UTS2 polyclonal antibody Go To Vendor
UTS2 epitope: TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV See NCBI gene human
(Atlas Antibodies Cat# HPA017000, RRID:AB_1858656)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA017000