Showing 1 - 5 results out of 5 with the query:
AB_1859228
with sorting:
Proper Citation Descending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-ZNF384 antibody produced in rabbit
ZNF384 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA004051, RRID:AB_1859228)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA004051
ZNF384-human antibody Go To Vendor
ZNF384 homo sapiens
(Sigma-Aldrich Cat# HPA004051, RRID:AB_1859228)
polyclonal antibody
ENCODE PROJECT External validation DATA SET is released testing lot A57874 for HEK293T,K562,HeLa-S3; status is pending dcc review,eligible for new data
rabbit
Sigma-Aldrich
HPA004051
Anti-ZNF384 antibody produced in rabbit
Human ZNF384 human
(Sigma-Aldrich Cat# HPA004051, RRID:AB_1859228)
unknown
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA004051
ENCODE Project Antibody validation ZNF384_(HPA004051)
ZNF384 human
(Sigma-Aldrich Cat# HPA004051, RRID:AB_1859228)
polyclonal antibody
Rabbit polyclonal affinity purified generated using the immunogen: Zinc finger protein 384 recombinant protein epitope signature tag (PrEST)
Validation: ENCODE PROJECT validation information available
rabbit
Sigma-Aldrich
HPA004051
Anti-ZNF384 antibody Go To Vendor
ZNF384 epitope: SHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTA See NCBI gene human
(Atlas Antibodies Cat# HPA004051, RRID:AB_1859228)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA004051