Showing 1 - 2 results out of 2 with the query:
AB_2673233
with sorting:
Vendor Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-MRPL10 antibody Go To Vendor
MRPL10 epitope: RLPTLQTVRYGSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRREIAAVFQDNRMIAVCQ See NCBI gene human
(Atlas Antibodies Cat# HPA029885, RRID:AB_2673233)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA029885
Anti-MRPL10 antibody
MRPL10 human
(Sigma-Aldrich Cat# HPA029885, RRID:AB_2673233)
polyclonal antibody
rabbit
Sigma-Aldrich
HPA029885