Showing 1 - 2 results out of 2 with the query:
AB_2673594
with sorting:
Target Antigen Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-OGT antibody
OGT human
(Sigma-Aldrich Cat# HPA030753, RRID:AB_2673594)
polyclonal antibody
rabbit
Sigma-Aldrich
HPA030753
Anti-OGT antibody Go To Vendor
OGT epitope: YCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRL See NCBI gene human
(Atlas Antibodies Cat# HPA030753, RRID:AB_2673594)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA030753