Showing 1 - 2 results out of 2 with the query:
AB_2681298
with sorting:
Clonality Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-ZNF524 antibody
ZNF524 human
(Sigma-Aldrich Cat# HPA050981, RRID:AB_2681298)
polyclonal antibody
rabbit
Sigma-Aldrich
HPA050981
Anti-ZNF524 antibody Go To Vendor
ZNF524 epitope: CRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPWDEEGIPATA See NCBI gene human
(Atlas Antibodies Cat# HPA050981, RRID:AB_2681298)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA050981