Showing 1 - 1 results out of 1 with the query:
AB_2684416
with sorting:
Host Organism Ascending X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-PLEKHO1 polyclonal antibody
PLEKHO1 See NCBI gene human
(Atlas Antibodies Cat# HPA061018, RRID:AB_2684416)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVDLD; Manufacturer approved use: ICC-IF, WB
rabbit
Atlas Antibodies Go To Vendor
HPA061018