Showing 1 - 1 results out of 1 with the query:
AB_2833139
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-Spike glycoprotein Antibody, clone 2B2
Spike glycoprotein epitope: FFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSF severe acute respiratory syndrome-related coronavirus
(Imported from the IEDB Cat# 2B2, RRID:AB_2833139)
monoclonal antibody
2B2
mus musculus balb, c
Imported from the IEDB
2B2