Showing 1 - 1 results out of 1 with the query:
AB_2833180
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-Spike glycoprotein Antibody, clone 9A
Spike glycoprotein epitope: ALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL severe acute respiratory syndrome-related coronavirus
(Imported from the IEDB Cat# 9A, RRID:AB_2833180)
monoclonal antibody
9A
mouse
Imported from the IEDB
9A