Showing 1 - 1 results out of 1 with the query:
AB_2833190
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-Spike glycoprotein Antibody, clone E10E-1-10
Spike glycoprotein epitope: VSGFWTIASTNFVDALIEVQGTAIQRILYCDDPVSQLKCSQVAFDLDDGFY porcine epidemic diarrhea virus
(Imported from the IEDB Cat# E10E-1-10, RRID:AB_2833190)
monoclonal antibody
E10E-1-10
mouse
Imported from the IEDB
E10E-1-10