Showing 1 - 1 results out of 1 with the query:
AB_2848005
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-Spike glycoprotein precursor Antibody, clone 4E5
Spike glycoprotein precursor epitope: ALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL sars coronavirus pumc01
(Imported from the IEDB Cat# 4E5, RRID:AB_2848005)
monoclonal antibody
Validation: assays with positive results - PMID 27627203: biological activity (neutralization), ELISA (qualitative binding), surface plasmon resonance (dissociation constant KD)
4E5
mus musculus
Imported from the IEDB
4E5