Showing 1 - 1 results out of 1 with the query:
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clone ID
Host Organism
Cat Num
Anti-Spike glycoprotein precursor Antibody, clone 3E10
Spike glycoprotein precursor epitope: ALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL severe acute respiratory syndrome-related coronavirus
(Imported from the IEDB Cat# 3E10, RRID:AB_2848061)
monoclonal antibody
Validation: assays with positive results - PMID 27627203: surface plasmon resonance (dissociation constant KD)
Imported from the IEDB