Showing 1 - 1 results out of 1 with the query:
AB_2848061
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Clonality
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-Spike glycoprotein precursor Antibody, clone 3E10
Spike glycoprotein precursor epitope: ALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL severe acute respiratory syndrome-related coronavirus
(Imported from the IEDB Cat# 3E10, RRID:AB_2848061)
monoclonal antibody
Validation: assays with positive results - PMID 27627203: surface plasmon resonance (dissociation constant KD)
3E10
mus musculus
Imported from the IEDB
3E10